PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof004565
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HD-ZIP
Protein Properties Length: 204aa    MW: 21801.2 Da    PI: 6.7952
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-123111PU_refplantGDBView CDS
gnl|UG|Sof#S17414206PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.73.5e-121253256
               HHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox 32 eLAkklgLterqVkvWFqNrRakek 56
               +LA+ lgL+ rqV +WFqNrRa++k
  Sof004565  1 QLARALGLQPRQVAIWFQNRRARWK 25
               79**********************9 PP

2HD-ZIP_I/II85.95.3e-281633193
  HD-ZIP_I/II 31 elareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93
                 +lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aL+r++da ++en++L +++++L++e+++
    Sof004565  1 QLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALRRQLDAARAENDALLAHNKKLQAEIMA 63
                 79********************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.41E-11137IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-12135IPR009057Homeodomain-like
PROSITE profilePS5007113.264127IPR001356Homeobox domain
PfamPF000461.5E-9125IPR001356Homeobox domain
CDDcd000864.18E-10128No hitNo description
PROSITE patternPS000270225IPR017970Homeobox, conserved site
PfamPF021833.9E-132766IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
QLARALGLQP RQVAIWFQNR RARWKTKQLE KDYDALRRQL DAARAENDAL LAHNKKLQAE  60
IMALKGGGGG GGRQEAASEL INLNVKETEA SCSNRSENSS EINLDISRPQ AAPPAADESP  120
TMNSYRGLPF YASAARADID QLLQSGHHPS PPAAPKMELG HGAADTAPAT VGGGGGTFGS  180
LLCGAAVDEQ PPFWPWADGH HSFQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11927RRARWKTKQ
26472KGGGGGGGR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.172600.0bud| inflorescence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983144.11e-106PREDICTED: homeobox-leucine zipper protein HOX23-like
SwissprotA2Z7347e-80HOX23_ORYSI; Homeobox-leucine zipper protein HOX23
SwissprotQ94GL57e-80HOX23_ORYSJ; Homeobox-leucine zipper protein HOX23
TrEMBLC5WM881e-100C5WM88_SORBI; Putative uncharacterized protein Sb01g022420
STRINGSb01g022420.11e-100(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.14e-38HD-ZIP family protein